CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4

Entry of glycoprotein extracted from GlycoProtDB


Summary
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
  • GlycoProtDB: GPDB0007103
  • UniProt ID: Q91Y74
  • Gene Symbol: St3gal4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 131 23002422
2 310 17406563
22823882
23002422

Sequence

MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPISEKKEPCFQGEAERQASKIFGNRSREQPIFLQLKDYFWVKTPSTYELPFGTKGSEDLLLRVLAITSYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDASNKKQTIHYYEQITLKSMAGSGHNVSQEAIAIKRMLEMGAVKNLTYF

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0