Adamtsl4 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adamtsl4 protein
  • GlycoProtDB: GPDB0007111
  • UniProt ID: Q91YP4
  • Gene Symbol: Adamtsl4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 107 22823882
2 113 22823882
3 162 22823882

Sequence

MGPCTTAWFYSDWSSKCSAECGTGIQRRAVVCLRSGETLQGDPEAGSTEQGCPLRSRPPDMRACSLGPCERTWRWFTGPWSECSSECGSGTQHRDIICVSKLGAEFNVTSPSNCSHLPRPPALQPCQGQACEDKWFSTLWSPCSRSCQGGMQTREVQCLSGNQTLSSRCPPHLRPSRKRPCNSQPCNQRPDDQCKDSSPHCPLVVQARLCVYPYYTTTCCRSCAHVLEQSQLEPA

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0