CD86 antigen

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD86 antigen
  • GlycoProtDB: GPDB0007116
  • UniProt ID: Q91YV7
  • Gene Symbol: Cd86
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 92 23002422

Sequence

MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLDQNVTGNSGINLTCMSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSAQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0