CD209 antigen-like protein D

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD209 antigen-like protein D
  • GlycoProtDB: GPDB0007131
  • UniProt ID: Q91ZW8
  • Gene Symbol: Cd209d
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 114 22823882

Sequence

MSDSMESKTQQVVIPEDEECLMSGTRYSDISSRLQTKFGIKSLAEYTKQSRNPLVLQLLSFLFLAGLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFFSKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWHWVDGSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICKKVSTSSCTTK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0