CD14 antigen (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD14 antigen (Fragment)
  • GlycoProtDB: GPDB0007144
  • UniProt ID: Q920X7
  • Gene Symbol: CD14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 170 23002422
2 263 22823882
3 304 ---

Sequence

LLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLRLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKYNSGVVTAGAPSSQAVALSGTLALLLGDRLFV

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0