Alpha-2,3-sialyltransferase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-2,3-sialyltransferase
  • GlycoProtDB: GPDB0007152
  • UniProt ID: Q921R5
  • Gene Symbol: St3gal4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 131 23002422
2 310 17406563
22823882
23002422

Sequence

MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPISEKKEPCFQGEAERQASKIFGNRSRDQPIFLQLKDYFWVKTPSTYELPFGTKGSEDLLLRVLAITSYSIPESIKSLECRRCVVVGNGHRLRNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQVRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDASNKKQTIHYYEQITLKSMAGSGHNVSQEAIAIKRMLEMGAVKNLTYF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0