Ashwin

Entry of glycoprotein extracted from GlycoProtDB


Summary
Ashwin
  • GlycoProtDB: GPDB0007161
  • UniProt ID: Q922M7
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 169 22823882

Sequence

MAGDVGGRSCTDAELLLHPELLSQEFLLLTLEQKNIAVENEVRVNKDNLTDLYVQHAIPLPQRDLPKNRWGKMMEKKREHHEVKNDTKRSSAVDGLRKRPLIVFDGSSTSTSIKVKRTENGADDRLKPLAQIGSTSDAFWKSPNSSSRISPLVLFSNLPVNHKMEHNNNDTQQNHDLMNRKSPSGPVKSPPLSPVGTTPVKLKRAAPKEEAEATNHLKPPEVKRKIQHVTWP

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0