Carcinoembryonic antigen family member protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carcinoembryonic antigen family member protein
  • GlycoProtDB: GPDB0007195
  • UniProt ID: Q99232
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 195 17406563
22823882
23002422

Sequence

MELASAHLHKGQVPWVGLLLTASLLASWSPPTTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNPVSTNAEIVHFVTGTNKTTTGPAHSGRETVYSNGSLLIQRVTVKDTGVYTIEMTDENFRRTEATVQFHVHQPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0