Cannabinoid receptor 1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cannabinoid receptor 1 (Fragment)
  • GlycoProtDB: GPDB0007263
  • UniProt ID: Q99NU3
  • Gene Symbol: Cnr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 26 17406563
22823882
2 32 17406563
22823882

Sequence

FRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFC

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0