Arylacetamide deacetylase

Entry of glycoprotein extracted from GlycoProtDB


Summary
Arylacetamide deacetylase
  • GlycoProtDB: GPDB0007268
  • UniProt ID: Q99PG0
  • Gene Symbol: Aadac
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 281 17406563
22823882

Sequence

MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGELLGISHFMETIQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSMALRRGLFYIHGGGWCLGSAAHFSYDTLSRWTAHKLDAVVVSTDYGLAPKHHFPRQFEDVYRSLRWFLQEDVLEKYGVDPRRVGVSGDSAGGNLAAAVTQQLIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVLTRSLMVRFWSEYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPTPGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLMYVKRLQNVGVHVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0