Arylsulfatase K

Entry of glycoprotein extracted from GlycoProtDB


Summary
Arylsulfatase K
  • GlycoProtDB: GPDB0007358
  • UniProt ID: Q9D2L1
  • Gene Symbol: Arsk
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 496 17406563
22823882
23002422

Sequence

MLLLLVSVVAALALAAPAPRTQKKRMQVNQAPNVVLVASDSFDGRLTFQPGSQVVKLPFINFMRAHGTTFLNAYTNSPICCPSRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDIMEKHGYQTQKFGKVDYTSGHHSISNRVEAWTRDVAFLLRQEGRPIINLIPDKNRRRVMTKDWQNTDKAIEWLRQVNYTKPFVLYLGLNLPHPYPSPSSGENFGSSTFHTSLYWLEKVAYDAIKIPKWLTLSQMHPVDFYSSYTKNCTGKFTENEIKNIRAFYYAMCAETDAMLGEIILALHKLDLLQKTIVIYTSDHGEMAMEHRQFYKMSMYEASVHVPLLMMGPGIKANLQVPSVVSLVDIYPTMLDIAGIALPPNLSGYSLLTLLSNASANEQAFKFHRPPWILSEFHGCNANASTYMLRTGQWKYIAYADGASVQPQLFDLSLDPDELTNIATEFPEITYSLDQKLRSIVNYPKVSASVHQYNKEQFIMWKQSVGQNYSNVIAHLRWHQDWQRDPRKYENAIQHWLTAHSSPLASSPTQSTSGSQPTLPQSTSG

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0