Adipocyte plasma membrane-associated protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adipocyte plasma membrane-associated protein
  • GlycoProtDB: GPDB0007398
  • UniProt ID: Q9D7N9
  • Gene Symbol: Apmap
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 159 17406563
22823882

Sequence

MSEADGLRQRRPLRPQVVTDDGQVPEVKEGSSFSGRVFRMTFLMLAVSLAIPLLGAMMLLESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0