1700074P13Rik protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
1700074P13Rik protein
  • GlycoProtDB: GPDB0007422
  • UniProt ID: Q9D9G7
  • Gene Symbol: 1700074P13Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 91 22823882

Sequence

MKTFFIFTLLSLAVANTPKAVLKEYNNSEEYLPENFNVPYMVYLQSSPEPCVGTLIDPQWVLTAAHCSLPTKIRLGVYRPNIKNEKEQICNYSFTVVHPNFDAKLLKNDLMLIKLSYPATINMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILTWINEYSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKASVANGSKGFFTEIHPYARWILKMIRSH

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0