Calreticulin-3

Entry of glycoprotein extracted from GlycoProtDB


Summary
Calreticulin-3
  • GlycoProtDB: GPDB0007426
  • UniProt ID: Q9D9Q6
  • Gene Symbol: Calr3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 42 22823882

Sequence

MVSARALLWAICVLRVALATVYFQEEFLDGERWRNRWVQSTNDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRKTEKTSLDSRDWDQVEGSKVQDWEKHFLDAGASKPSDWNSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEMDAIQAKEEVKKAREEDEEDLLMGKFHRHNHFSRFHRQGEL

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0