Ceacam12 protein

Entry of glycoprotein extracted from GlycoProtDB


Summary
Ceacam12 protein
  • GlycoProtDB: GPDB0007441
  • UniProt ID: Q9DAS5
  • Gene Symbol: Ceacam12
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 87 22823882

Sequence

MMNSDALSCKDCTSWQELLLTVSILTCWLLPTTAQITIESVPPIAVEGDNVLLFVQNLPENVQTLSWYKGGKLLKMFEIARHVIATNSSVMGPAHSGRETMLNNGSLMIKNVTRKDSGYYTLQILDTTSRREIMRAEFFVQRPILGFRKHPTSQLKIEFVPPRIEENDDVLLLVYNLPENLQGFVWHKGVFPVDHFKIASHSFLTNSTMLGRTYLDRLTVCSDGSLLLSKVSQEDTGLYSLRTIPVDLMSESAIVYLKVNSK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0