CD302 antigen

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD302 antigen
  • GlycoProtDB: GPDB0007481
  • UniProt ID: Q9DCG2
  • Gene Symbol: Cd302
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 107 22823882
23002422

Sequence

MPHAALSSLVLLSLATAIVADCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAAIPYDKKYLSDNHILISTLVIASTVTLAVLGAIIWFLYRRNARSGFTSFSPAPLSPYSDGCALVVAEEDEYAVQLD

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0