Carbohydrate sulfotransferase 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carbohydrate sulfotransferase 1
  • GlycoProtDB: GPDB0007505
  • UniProt ID: Q9EQC0
  • Gene Symbol: Chst1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 189 17406563
22823882

Sequence

MQCSWKAVLLLALASIAIQYTAIRTFTAKSFHTCPGLTDTGLAERLCEEGPTFSYNLSRKTHVLILATTRSGSSFVGQLFNQHMDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDLLRSLYDCDLYFLENYIKPPPVNHTTNRVFRRGASRVLCSRPVCDPPGSSDLILEEGDCVRMCGLLNLTLAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNLDVTQLTTVCEDFSSSVSTGLMRPSWLKGKYMLVRYEDLARNPMKKTEEIYEFLGIPLDSHVAHWIQNNTRGDPTLGKHKYSTVRNSAATAEKWRFRLSYDIVAFAQNACQQVLAQLGYKMANSEEELKNPAISLVEERDFRPFL

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0