Cell surface glycoprotein CD200 receptor 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Cell surface glycoprotein CD200 receptor 1
  • GlycoProtDB: GPDB0007523
  • UniProt ID: Q9ES57
  • Gene Symbol: Cd200r1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 207 23002422
2 221 23002422

Sequence

MFCFWRTSALAVLLIWGVFVAGSSCTDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPYIPYIIPSIIILIIIGCICLLKISGFRKCKLPKLEATSAIEEDEMQPYASYTEKSNPLYDTVTKVEAFPVSQGEVNGTDCLTLSAIGI

Feature


PDB Images




Copyright © 2019    GlyCosmos Portal v1.2.0