Beta-1,4-galactosyltransferase 4

Entry of glycoprotein extracted from GlycoProtDB


Summary
Beta-1,4-galactosyltransferase 4
  • GlycoProtDB: GPDB0007565
  • UniProt ID: Q9JJ04
  • Gene Symbol: B4galt4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 220 22823882

Sequence

MGCNPPYHLSYRLRLLLLFTLCLTVVGWATSNYFVGAIQVIPKAKDFMASFHKVIHLGNEETLGHDGATKKPELANCPSVSPNLRGQSKLVFKPDLTLEEIEAENPKVSRGRYHPEECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0