Brain cDNA, clone MNCb-1208, similar to Mus musculus mitogen activated protein kinase kinase 1 (Map2k1), mRNA

Entry of glycoprotein extracted from GlycoProtDB


Summary
Brain cDNA, clone MNCb-1208, similar to Mus musculus mitogen activated protein kinase kinase 1 (Map2k1), mRNA
  • GlycoProtDB: GPDB0007567
  • UniProt ID: Q9JJE1
  • Gene Symbol: Map2k1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 21 22823882

Sequence

MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGGPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0