Carboxypeptidase N catalytic chain

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carboxypeptidase N catalytic chain
  • GlycoProtDB: GPDB0007573
  • UniProt ID: Q9JJN5
  • Gene Symbol: Cpn1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 353 22823882

Sequence

MPDLPSAFLPLLLLSKFVTPVTFRHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLEFSDYPGIHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPSMNPDGYEVAAAQGPNMSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKNGGPNHHLPLPDNWKSQVEPETRAVIQWIRSLNFVLSANMHGGAVVANYPYDKSLEHRFRGPHRTSNSPTPDDELFQTLAKVYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVLDENSNNLTGAVISVTGINHDVTSGEHGDYFRLLLPGTYSVTAKAPGYDPKTVTVTVGPAGPTVVDFQLKRSSSQVYPVQRAPGRGQGGRAKQPRTSRKKDPATKRHRGPA

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0