C-type lectin domain family 1 member B

Entry of glycoprotein extracted from GlycoProtDB


Summary
C-type lectin domain family 1 member B
  • GlycoProtDB: GPDB0007599
  • UniProt ID: Q9JL99
  • Gene Symbol: Clec1b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 120 17406563
22823882
23002422
2 134 17406563
22823882
23002422

Sequence

MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVALGIMSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0