Loading...

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6

Entry of glycoprotein extracted from GlycoProtDB



Glycosylation Sites

# Position PubMed ID
1 98 22823882
23002422
2 106 22823882
3 149 22823882
23002422
4 173 22823882

Sequence

MACSRPPSQCDPTTLPPGPPAGRWPLPFSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTPETVFIFWGPPNKMQKPQGSLLRVIQRAGLMFPNMEAYAVSPARMQQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

Feature


Pathway

Associated pathways from Reactome



Copyright © GlyCosmos Portal v1.3.0

Last updated: April 1, 2020