Adhesion protein RA175N

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adhesion protein RA175N
  • GlycoProtDB: GPDB0007675
  • UniProt ID: Q9QYL3
  • Gene Symbol: Cadm1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 18 22823882
2 157 22823882
23002422

Sequence

MIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYPCEASNIVGKAHSDYILYVYDTTATTEPAVHDSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0