Adenylate kinase isoenzyme 1

Entry of glycoprotein extracted from GlycoProtDB


Summary
Adenylate kinase isoenzyme 1
  • GlycoProtDB: GPDB0007714
  • UniProt ID: Q9R0Y5
  • Gene Symbol: Ak1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 155 22823882

Sequence

MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0