Carbohydrate sulfotransferase 4

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carbohydrate sulfotransferase 4
  • GlycoProtDB: GPDB0007725
  • UniProt ID: Q9R1I1
  • Gene Symbol: Chst4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 328 22823882

Sequence

MMLLKKGRLLMFLGSQVIVVALFIHMSVHRHLSQREESRRPVHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFTSSTAWKLHMAVRDLLRSVFLCDMSVFDAYMNPGPRKQSSLFQWEQSRALCSAPVCDFFPAHEISSPKHCKLLCGQQPFDMVEKACRSHGFVVLKEVRFLSLQALYPLLTDPSLNLHVVHLVRDPRAVFRSREHTTIELVVDSHIVLGQHLETIKEEDQPYYAMKIICKSQVDIVKAIQTLPEALQQRYLFLRYEDLVRAPLAQTTRLYKFVGLDFLPHLQTWVHNVTRGKGMGQHAFHTNARNALNVSQAWRWSLPYEKVSQLQDACGEAMDLLGYLQVRSQQEQGNLSLDLLSSSHILGQVFREG

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0