Aminopeptidase (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Aminopeptidase (Fragment)
  • GlycoProtDB: GPDB0007726
  • UniProt ID: Q9R1I4
  • Gene Symbol: Cpq
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 122 17406563
22823882
23002422

Sequence

DPGSMYPEEVVLVSGHLDSWDVGQGALDDGGGXFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGIGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMNLLQPLNVTKVFSNGEGTDISFRI

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0