CD48 antigen (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
CD48 antigen (Fragment)
  • GlycoProtDB: GPDB0007764
  • UniProt ID: Q9WTK9
  • Gene Symbol: No data
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 20 17406563
22823882
23002422

Sequence

YKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENDGALHIS

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0