Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3

Entry of glycoprotein extracted from GlycoProtDB


Summary
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  • GlycoProtDB: GPDB0007797
  • UniProt ID: Q9WUV2
  • Gene Symbol: St6galnac3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 301 23002422

Sequence

MACILKRKPVLVVSFIALCILLLAMRLVNDATFPLLLNCFGQPKTKWIPLPYTFRQPLRTHYGYINVRTQEPLQLNCNHCAIVSNSGQMVGQKVGEEIDHASCIWRMNNAPTKGFEEDVGYMTMVRVVSHTSVPLLLKNPDYFFKEASRTIYVIWGPFRNMRKDGNGIVYNMLKKTVDAYPDAQIYVTTEQQMTHCDRVFKDETGKDRVQSGSYLSTGWFTFILAMDACYSIHVYGMINETYCKTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHPNWTLS

Feature


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0