Carbonic anhydrase 14

Entry of glycoprotein extracted from GlycoProtDB


Summary
Carbonic anhydrase 14
  • GlycoProtDB: GPDB0007814
  • UniProt ID: Q9WVT6
  • Gene Symbol: Ca14
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 213 17406563
22823882
23002422

Sequence

MLFFALLLKVTWILAADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEMLGLGVGILAGCLCLLLAVYFIAQKIRKKRLGNRKSVVFTSARATTEA

Feature


PDB Images


Pathway

Associated pathways from Reactome




Copyright © 2019    GlyCosmos Portal v1.2.0