Allergin-1 (Fragment)

Entry of glycoprotein extracted from GlycoProtDB


Summary
Allergin-1 (Fragment)
  • GlycoProtDB: GPDB0007878
  • UniProt ID: S4R1V2
  • Gene Symbol: Milr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation Sites

# Position PubMed ID
1 10 23002422
2 20 23002422
3 32 23002422

Sequence

DFHLRISNANESGPYKCKVNVSNLMKYSQDFNFTMAKDESCPSCRLSLLLPGLLLGILVIVLVLAYLIHLKYKKGKKTQREDQSKGSGDAPAQDELYVNACKTQTEQPQEIHYATPVFKEMAPMEEEGGTDGKADYIYSELTH

Feature




Copyright © 2019    GlyCosmos Portal v1.2.0