Cell surface glycolipoprotein MPB83

Summary
External Links
Annotation
Keyword
  • Cell membrane
  • Cell wall
  • Glycoprotein
  • Palmitate
  • Signal
Gene Ontology (GO)
Displaying all 2 entries
GO Term
cell adhesion
extracellular matrix organization
Displaying all 3 entries
GO Term
extracellular space
plasma membrane
extracellular matrix
Displaying 1 entry
GO Term
cell adhesion molecule binding
Sequence
MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
Glycosylation Sites
Displaying all 2 entries
Position Description PubMed ID GlyTouCan ID Source
48 O-linked (Man...) threonine
49 O-linked (Man...) threonine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024