Glycoprotein hormones alpha chain

Annotation
Keyword
  • Direct protein sequencing
  • Disulfide bond
  • Glycoprotein
  • Hormone
  • Reference proteome
  • Secreted
  • Signal
Gene Ontology (GO)
Subcellular Location(GO Annotation)

Subcellular in which this glycoprotein is expressed are highlighted in blue.

Displaying 1 entry
GO Term
follicle-stimulating hormone activity
Sequence
MDYYRKYAAVILAILSLFLQILHSFPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: [email protected]

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.5.0

Last updated: April 6, 2026