Histone H2B

Summary
UniProt ID
P02283
Gene Symbol
  • His2B
  • His2B:CG17949
  • His2B:CG33868
  • His2B:CG33870
  • His2B:CG33872
  • His2B:CG33874
  • His2B:CG33876
  • His2B:CG33878
  • His2B:CG33880
  • His2B:CG33882
  • His2B:CG33884
  • His2B:CG33886
  • His2B:CG33888
  • His2B:CG33890
  • His2B:CG33892
  • His2B:CG33894
  • His2B:CG33896
  • His2B:CG33898
  • His2B:CG33900
  • His2B:CG33902
  • His2B:CG33904
  • His2B:CG33906
  • His2B:CG33908
  • His2B:CG33910
Organism
Drosophila melanogaster (fruit fly)
External Links
PubChem
P02283
Annotation
Keyword
  • 3D-structure
  • Direct protein sequencing
  • Glycoprotein
  • Isopeptide bond
  • Methylation
  • Nucleosome core
  • Nucleus
  • Reference proteome
  • Ubl conjugation
Gene Ontology (GO)
Sequence
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Glycosylation Sites
Displaying 1 entry
Position Description PubMed ID GlyTouCan ID Source
110 O-linked (GlcNAc) serine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt
Pathway
Displaying entries 1 - 10 of 18 in total
Pathway Name Organism
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 Drosophila melanogaster
Assembly of the ORC complex at the origin of replication Drosophila melanogaster
Condensation of Prophase Chromosomes Drosophila melanogaster
E3 ubiquitin ligases ubiquitinate target proteins Drosophila melanogaster
Estrogen-dependent gene expression Drosophila melanogaster
Formation of the beta-catenin:TCF transactivating complex Drosophila melanogaster
HATs acetylate histones Drosophila melanogaster
HDACs deacetylate histones Drosophila melanogaster
NoRC negatively regulates rRNA expression Drosophila melanogaster
Oxidative Stress Induced Senescence Drosophila melanogaster

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024