Rano class II histocompatibility antigen, B alpha chain

Summary
UniProt ID
P20037
Gene Symbol
  • RT1-Ba
Organism
Rattus norvegicus (Norway rat)
External Links
Sequence
MPLSRALILGVLALTTMLSPCGGQDDIEADHVGSYGITVYQYHESKGQYTHEFDGDERFYVDLDKKETIWRIPEFGQLISFDPQGALRNIAIIKHNLEILMKRSNSTPAVNEVPEATVFSKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKPLTEGVYETSFLINSDYSFHKMAYLTFIPSNDDIYDCKVEHWSLDEPVLRHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFIIQGLRSVAPSRHPGPL
Glycosylation Sites
Displaying 1 entry
Position Description PubMed ID GlyTouCan ID Source
145 N-linked (GlcNAc...) asparagine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt
Pathway
Displaying all 6 entries
Pathway Name Organism
Downstream TCR signaling Rattus norvegicus
Generation of second messenger molecules Rattus norvegicus
MHC class II antigen presentation Rattus norvegicus
PD-1 signaling Rattus norvegicus
Phosphorylation of CD3 and TCR zeta chains Rattus norvegicus
Translocation of ZAP-70 to Immunological synapse Rattus norvegicus

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024