Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms
Isocitrate dehydrogenase [NADP], mitochondrial
Summary
- UniProt ID
- P48735
- Gene Symbol
-
- IDH2
- Organism
- Homo sapiens (human)
External Links
- GlyGen
- P48735
- PubChem
- P48735
- The Human Metabolome Database
- HMDBP00896
- The O-GlcNAc Database
- P48735
- RaftProt
- P48735
Annotation
- Keyword
-
- 3D-structure
- Acetylation
- Alternative splicing
- Disease variant
- Glyoxylate bypass
- Magnesium
- Manganese
- Metal-binding
- Mitochondrion
- NADP
- Oxidoreductase
- Reference proteome
- Transit peptide
- Tricarboxylic acid cycle
- Gene Ontology (GO)
| GO Term |
|---|
| glyoxylate cycle |
| isocitrate metabolic process |
| 2-oxoglutarate metabolic process |
| NADP metabolic process |
| carbohydrate metabolic process |
| tricarboxylic acid cycle |
| GO Term |
|---|
| extracellular exosome |
| mitochondrion |
| mitochondrial matrix |
| peroxisome |
| cytosol |
| GO Term |
|---|
| magnesium ion binding |
| isocitrate dehydrogenase (NADP+) activity |
| NAD binding |
Sequence
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
|
|
G49108TO
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Citric acid cycle (TCA cycle) | Homo sapiens |
| Maturation of TCA enzymes and regulation of TCA cycle | Homo sapiens |
| Mitochondrial protein degradation | Homo sapiens |
| Transcriptional activation of mitochondrial biogenesis | Homo sapiens |
Human Protein Atlas
Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.
Disease
| DO ID | Disease Name | Source |
|---|---|---|
| DOID:0110278 | autosomal recessive limb-girdle muscular dystrophy type 2D | |
| DOID:0110279 | autosomal recessive limb-girdle muscular dystrophy type 2E | |
| DOID:0110280 | autosomal recessive limb-girdle muscular dystrophy type 2F | |
| DOID:0110281 | autosomal recessive limb-girdle muscular dystrophy type 2G | |
| DOID:0110282 | autosomal recessive limb-girdle muscular dystrophy type 2H | |
| DOID:0110283 | autosomal recessive limb-girdle muscular dystrophy type 2J | |
| DOID:0110284 | autosomal recessive limb-girdle muscular dystrophy type 2L | |
| DOID:0110285 | autosomal recessive limb-girdle muscular dystrophy type 2Q | |
| DOID:0110286 | obsolete autosomal recessive limb-girdle muscular dystrophy type 2R | |
| DOID:0110287 | autosomal recessive limb-girdle muscular dystrophy type 2S |
