Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms
Glycogen synthase kinase-3 beta
Summary
- UniProt ID
- P49841
- Gene Symbol
-
- GSK3B
- Organism
- Homo sapiens (human)
External Links
- PubChem
- P49841
- The Human Metabolome Database
- HMDBP01162
- The O-GlcNAc Database
- P49841
- RaftProt
- P49841
- O-GlcNAcAtlas
- P49841
Annotation
- Keyword
-
- 3D-structure
- ADP-ribosylation
- ATP-binding
- Alternative splicing
- Alzheimer disease
- Biological rhythms
- Cell membrane
- Cytoplasm
- Developmental protein
- Diabetes mellitus
- Differentiation
- Glycogen metabolism
- Neurogenesis
- Nucleus
- Palmitate
- Phosphoprotein
- Reference proteome
- Serine/threonine-protein kinase
- Signal transduction inhibitor
- Wnt signaling pathway
- Gene Ontology (GO)
| GO Term |
|---|
| positive regulation of GTPase activity |
| positive regulation of protein export from nucleus |
| regulation of dendrite morphogenesis |
| superior temporal gyrus development |
| regulation of long-term synaptic potentiation |
| GO Term |
|---|
| presynapse |
| postsynapse |
| centrosome |
| beta-catenin destruction complex |
| Wnt signalosome |
| glutamatergic synapse |
| nucleoplasm |
| cytosol |
| nucleus |
| cytoplasm |
| GO Term |
|---|
| dynactin binding |
| tau protein binding |
| protease binding |
| p53 binding |
| protein kinase activity |
| protein serine/threonine kinase activity |
| ATP binding |
| protein kinase binding |
| ubiquitin protein ligase binding |
| protein kinase A catalytic subunit binding |
Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 368 |
|
|||
| 369 |
|
|||
| 389 |
|
|||
| 390 |
|
|||
| 392 |
|
|||
| 395 |
|
|||
| 398 |
|
|||
| 402 |
|
|||
| 408 |
|
|||
| 413 |
|
G49108TO
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| AKT phosphorylates targets in the cytosol | Homo sapiens |
| APC truncation mutants have impaired AXIN binding | Homo sapiens |
| AXIN missense mutants destabilize the destruction complex | Homo sapiens |
| B-WICH complex positively regulates rRNA expression | Homo sapiens |
| Beta-catenin phosphorylation cascade | Homo sapiens |
| CRMPs in Sema3A signaling | Homo sapiens |
| CTNNB1 S33 mutants aren't phosphorylated | Homo sapiens |
| CTNNB1 S37 mutants aren't phosphorylated | Homo sapiens |
| CTNNB1 S45 mutants aren't phosphorylated | Homo sapiens |
| CTNNB1 T41 mutants aren't phosphorylated | Homo sapiens |
Human Protein Atlas
Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.
