Putative meiotic phospholipase SPO1

Summary
UniProt ID
P53541
Gene Symbol
  • SPO1
Organism
Saccharomyces cerevisiae S288C
Annotation
Keyword
  • Endoplasmic reticulum
  • Glycoprotein
  • Hydrolase
  • Lipid degradation
  • Meiosis
  • Nucleus
  • Reference proteome
  • Signal
  • Sporulation
  • Transmembrane helix
Gene Ontology (GO)
Sequence
MQKLLFVFSVLLTVVLATAPFQVQCPSSPLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFSSKFYKRVLKDPPKIGIAISGGGYRSMLVGTGFISQMNDYGLFEYSDYIAGLSGGSWILMDLVVQNFEVKSLLQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKKRQGGSLITSSSNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAKIETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPIFVANCKNGLLSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKAEKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISKDSSRLETDYAVYQPNPFYLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPERELDVIFVLDSSSDIDNYPNGSKLKRIFEKLDEENVHYQFPNNVKTFTHPIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTGRGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS
Glycosylation Sites
Displaying all 8 entries
Position Description PubMed ID GlyTouCan ID Source
233 N-linked (GlcNAc...) asparagine
293 N-linked (GlcNAc...) asparagine
303 N-linked (GlcNAc...) asparagine
500 N-linked (GlcNAc...) asparagine
536 N-linked (GlcNAc...) asparagine
560 N-linked (GlcNAc...) asparagine
563 N-linked (GlcNAc...) asparagine
572 N-linked (GlcNAc...) asparagine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt
Pathway
Displaying entries 1 - 10 of 14 in total
Pathway Name Organism
ADP signalling through P2Y purinoceptor 1 Saccharomyces cerevisiae
Acyl chain remodeling of CL Saccharomyces cerevisiae
Acyl chain remodelling of PC Saccharomyces cerevisiae
Acyl chain remodelling of PE Saccharomyces cerevisiae
Acyl chain remodelling of PG Saccharomyces cerevisiae
Acyl chain remodelling of PI Saccharomyces cerevisiae
Acyl chain remodelling of PS Saccharomyces cerevisiae
Arachidonate metabolism Saccharomyces cerevisiae
COPI-independent Golgi-to-ER retrograde traffic Saccharomyces cerevisiae
Hydrolysis of LPC Saccharomyces cerevisiae

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.1.0

Last updated: December 9, 2024