Dauer larva development regulatory growth factor daf-7

Summary
UniProt ID
P92172
Gene Symbol
  • daf-7
Organism
Caenorhabditis elegans
External Links
Annotation
Keyword
  • Cleavage on pair of basic residues
  • Developmental protein
  • Disulfide bond
  • Glycoprotein
  • Growth factor
  • Reference proteome
  • Secreted
  • Signal
Gene Ontology (GO)
Sequence
MFMASSLPVFIFLLSLPHGLTFNCTNSGVCIEKMKQHRTEYLKNEILDQLNMKEAPKGLKPMDPEMKSVYLEMYRDLLEKDEQDMGVEMSFYTAKDPSYGENPSQLVAKFDVTNDLERSDILQATLTVSIEIPAKDSGMLQDVQVQVYEKNEDGSMGEMVTSGIFATKGSERISIQLPIDTVKSWFTISPIQGIFVKAMLDGRNVALHPQQTTADVDNMRLQLSTRPKGSRKRRSHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS
Glycosylation Sites
Displaying 1 entry
Position Description PubMed ID GlyTouCan ID Source
23 N-linked (GlcNAc...) asparagine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt
Pathway
Displaying entries 1 - 10 of 12 in total
Pathway Name Organism
Downregulation of TGF-beta receptor signaling Caenorhabditis elegans
Molecules associated with elastic fibres Caenorhabditis elegans
Platelet degranulation Caenorhabditis elegans
Post-translational protein phosphorylation Caenorhabditis elegans
RUNX3 regulates CDKN1A transcription Caenorhabditis elegans
RUNX3 regulates p14-ARF Caenorhabditis elegans
Regulation of IGF Activity by IGFBP Caenorhabditis elegans
Regulation of RUNX3 expression and activity Caenorhabditis elegans
Signaling by BMP Caenorhabditis elegans
Syndecan interactions Caenorhabditis elegans

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024