Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms
Envelope glycoprotein p57
Summary
- UniProt ID
- Q8BB27
- Gene Symbol
-
- G
- Organism
- Borna disease virus 1
External Links
Annotation
- Keyword
-
- Alternative splicing
- Clathrin-mediated endocytosis of virus by host
- Cleavage on pair of basic residues
- Fusion of virus membrane with host endosomal membrane
- Glycoprotein
- Host cell membrane
- Host endoplasmic reticulum
- Signal
- Transmembrane helix
- Viral attachment to host cell
- Viral envelope protein
- Gene Ontology (GO)
| GO Term |
|---|
| virion attachment to host cell |
| fusion of virus membrane with host endosome membrane |
| clathrin-dependent endocytosis of virus by host cell |
| GO Term |
|---|
| membrane |
| viral envelope |
| host cell plasma membrane |
| host cell endoplasmic reticulum membrane |
Sequence
MNSKHSYVELKDKVIVPGWPTLMLEIDFVGGTSRNQFLNIPFLSVKEPLQLPREKKLTDYFTIDVEPAGHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKHAINAAFNVFSYRLRNIGVGPLGPDIRSSGP
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 63 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 109 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 139 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 192 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 196 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 202 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 221 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 230 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 235 | N-linked (GlcNAc...) asparagine; by host |
|
||
| 321 | N-linked (GlcNAc...) asparagine; by host |
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
