Hemagglutinin

Summary
External Links
Annotation
Keyword
  • Clathrin- and caveolin-independent endocytosis of virus by host
  • Clathrin-mediated endocytosis of virus by host
  • Disulfide bond
  • Fusion of virus membrane with host endosomal membrane
  • Glycoprotein
  • Hemagglutinin
  • Host cell membrane
  • Palmitate
  • Signal
  • Transmembrane helix
  • Viral attachment to host cell
  • Viral envelope protein
Gene Ontology (GO)
Sequence
MEAKLFVLFCAFTTLEADTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENSHNGKLCSLNGVAPLQLGKCNVAGWILGNPECDLLLTANSWSYIIETSDSENGTCYPGEFIDYEELREQLSSVSSFERFEIFPKANSWPNHETTKGITAACSYSGTLSFYRNLLWIVKRGNSYPKLSKSYTNNKGKEVLIIWGVHHPPTTSDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVKGQAGRMNYYWTLLDQGDTITFEATGNLIAPWYAFALNKGSGSGIITSDTPVHNCDTKCQTPHGALNSSLPFQNVHPITIGECPKYVKSTKLRMATGLRNVPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQIAIDGISNKVNSVIEKMNTQFTAVGKEFNDLEKRIENLNKKVDDGFLDVWTYNAELLVLLENERTLDFHDFNVRNLYEKVKSQLRNNAKEIGNGCFEFYHKCDDECMESVKNGTYNYPKYSEESKLNREEIDGVKLESMEVYQILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI
Glycosylation Sites
Displaying all 6 entries
Position Description PubMed ID GlyTouCan ID Source
27 N-linked (GlcNAc...) asparagine; by host
28 N-linked (GlcNAc...) asparagine; by host
40 N-linked (GlcNAc...) asparagine; by host
104 N-linked (GlcNAc...) asparagine; by host
304 N-linked (GlcNAc...) asparagine; by host
498 N-linked (GlcNAc...) asparagine; by host
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024