Putative galacturan 1,4-alpha-galacturonidase C

Summary
UniProt ID
A2RAY7
Gene Symbol
  • rgxC
Organism
Aspergillus niger CBS 513.88
External Links
Annotation
Keyword
  • Cell wall biogenesis/degradation
  • Disulfide bond
  • Glycoprotein
  • Glycosidase
  • Polysaccharide degradation
  • Reference proteome
  • Repeat
  • Secreted
  • Signal
Gene Ontology (GO)
Displaying all 2 entries
GO Term
cell wall organization
polysaccharide catabolic process
Displaying 1 entry
GO Term
extracellular region
Sequence
MQLRASVLLSFLGLASVGHAGNVENNHNVCTVRANGGHQDDVPNIMAAFKECGNGGTIIFPEDQSYWIATRLHPTLKDVAIEWRGKWTFSDNLTYWRNNSYPIAFQNHHAGFIISGDNITINGYGTGGIDGNGNTWYTAEKGDTQPGRPMPFVFWNVSEVIVDSFYVKDPPLWSVNIMNGTNMRFNNIYCNATAVDAPWGDNWVQNTDGFDTMDATNIQLTNFVYQGGDDCIAIKPRSYNIDIQNVTCRGGNGIAIGSLGQYLEDSSVANIRVDKVNIIRYNEDMHNSAYLKTWVGALVPQSSYESAGVPRGDGWGSIRNVLFSNFNVQGASAGPSISQDSGDNGSYAGTSKMSISNVAFVNFTGWVDTEKSVVSTVSCSEVHPCYNIDYDNVVLYPGKNATTAGTGSCKYTADGGVHGLSGC
Glycosylation Sites
Displaying all 10 entries
Position Description PubMed ID GlyTouCan ID Source
92 N-linked (GlcNAc...) asparagine
98 N-linked (GlcNAc...) asparagine
118 N-linked (GlcNAc...) asparagine
156 N-linked (GlcNAc...) asparagine
179 N-linked (GlcNAc...) asparagine
191 N-linked (GlcNAc...) asparagine
245 N-linked (GlcNAc...) asparagine
344 N-linked (GlcNAc...) asparagine
362 N-linked (GlcNAc...) asparagine
400 N-linked (GlcNAc...) asparagine
Feature
  • ProtVista GlyGen : Glycosylation Site from GlyGen
  • ProtVista UniProt : Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.


International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01


Logo License Policies Site Map

Contact: support@glycosmos.org

This work is licensed under Creative Commons Attribution 4.0 International


GlyCosmos Portal v4.0.0

Last updated: August 19, 2024