Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms
Glycogen synthase kinase-3 beta
Summary
- UniProt ID
- Q9WV60
- Gene Symbol
-
- Gsk3b
- Organism
- Mus musculus (house mouse)
Annotation
- Keyword
-
- 3D-structure
- ADP-ribosylation
- ATP-binding
- Biological rhythms
- Cell membrane
- Cytoplasm
- Developmental protein
- Differentiation
- Glycogen metabolism
- Neurogenesis
- Nucleus
- Palmitate
- Phosphoprotein
- Reference proteome
- Serine/threonine-protein kinase
- Signal transduction inhibitor
- Wnt signaling pathway
- Gene Ontology (GO)
| GO Term |
|---|
| meiosis I |
| stem cell differentiation |
| regulation of cell growth |
| glycogen metabolic process |
| cytoskeleton organization |
| circadian rhythm |
| animal organ morphogenesis |
| positive regulation of gene expression |
| phosphorylation |
| cell migration |
| GO Term |
|---|
| nucleoplasm |
| perinuclear region of cytoplasm |
| nucleus |
| cytoplasm |
| mitochondrion |
| plasma membrane |
| axon |
| dendrite |
| protein-containing complex |
| neuronal cell body |
| GO Term |
|---|
| kinase activity |
| tau protein binding |
| protein serine/threonine kinase binding |
| p53 binding |
| protein kinase activity |
| protein serine/threonine kinase activity |
| integrin binding |
| ATP binding |
| protein kinase binding |
| tau-protein kinase activity |
Sequence
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Glycosylation Sites
G49108TO
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| B-WICH complex positively regulates rRNA expression | Mus musculus |
| Beta-catenin phosphorylation cascade | Mus musculus |
| CRMPs in Sema3A signaling | Mus musculus |
| Degradation of beta-catenin by the destruction complex | Mus musculus |
| Disassembly of the destruction complex and recruitment of AXIN to the membrane | Mus musculus |
| GLI3 is processed to GLI3R by the proteasome | Mus musculus |
| GSK3B and BTRC:CUL1-mediated-degradation of NFE2L2 | Mus musculus |
| Regulation of HSF1-mediated heat shock response | Mus musculus |
| Transcriptional and post-translational regulation of MITF-M expression and activity | Mus musculus |
