GlyCosmos Portal

Dynein light chain 1, cytoplasmic

UniProt ID

P63168

Gene Symbol

Organism

Mus musculus (house mouse)

Keyword

Displaying **all 9** entries
GO Term
positive regulation of insulin secretion involved in cellular response to glucose stimulus
motile cilium assembly
negative regulation of nitric oxide biosynthetic process
apoptotic process
regulation of mitochondrial membrane potential
intraciliary retrograde transport
negative regulation of DNA strand resection involved in replication fork processing
positive regulation of non-motile cilium assembly
mitocytosis

Displaying **all 9** entries
GO Term
enzyme inhibitor activity
enzyme binding
protein-containing complex binding
protein domain specific binding
nitric-oxide synthase regulator activity
identical protein binding
dynein intermediate chain binding
nitric-oxide synthase inhibitor activity
scaffold protein binding

Annotation information from UniProt.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
			G49108TO	GlyGen The O-GlcNAc Database

Feature

Pathway

Displaying entries **1 - 10** of 22 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
AURKA Activation by TPX2	Mus musculus
Activation of BIM and translocation to mitochondria	Mus musculus
Aggrephagy	Mus musculus
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal	Mus musculus
Anchoring of the basal body to the plasma membrane	Mus musculus
COPI-independent Golgi-to-ER retrograde traffic	Mus musculus
COPI-mediated anterograde transport	Mus musculus
EML4 and NUDC in mitotic spindle formation	Mus musculus
HSP90 chaperone cycle for SHRs	Mus musculus
Intraflagellar transport	Mus musculus