GlyCosmos Portal

Dynein light chain 1, cytoplasmic

UniProt ID

P63168

Gene Symbol

Organism

Mus musculus (house mouse)

Keyword

Displaying **all 9** entries
GO Term
positive regulation of insulin secretion involved in cellular response to glucose stimulus
motile cilium assembly
negative regulation of nitric oxide biosynthetic process
apoptotic process
regulation of mitochondrial membrane potential
intraciliary retrograde transport
negative regulation of DNA strand resection involved in replication fork processing
positive regulation of non-motile cilium assembly
mitocytosis

Displaying **all 9** entries
GO Term
nitric-oxide synthase inhibitor activity
scaffold protein binding
protein domain specific binding
nitric-oxide synthase regulator activity
identical protein binding
dynein intermediate chain binding
enzyme inhibitor activity
enzyme binding
protein-containing complex binding

Annotation information from UniProt.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
			G49108TO	GlyGen The O-GlcNAc Database

Feature

Pathway

Displaying entries **11 - 20** of 22 in total

« First

‹ Prev

1

2

3

Next ›

Last »
Pathway Name	Organism
Loss of Nlp from mitotic centrosomes	Mus musculus
Loss of proteins required for interphase microtubule organization from the centrosome	Mus musculus
MHC class II antigen presentation	Mus musculus
Macroautophagy	Mus musculus
Mitotic Prometaphase	Mus musculus
Neutrophil degranulation	Mus musculus
RHO GTPases Activate Formins	Mus musculus
Recruitment of NuMA to mitotic centrosomes	Mus musculus
Recruitment of mitotic centrosome proteins and complexes	Mus musculus
Regulation of PLK1 Activity at G2/M Transition	Mus musculus